DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and aga

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_002934303.3 Gene:aga / 100485379 XenbaseID:XB-GENE-1001622 Length:347 Species:Xenopus tropicalis


Alignment Length:357 Identity:141/357 - (39%)
Similarity:203/357 - (56%) Gaps:34/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQSCCLRLLILLLLFTTIGSVPKKSLKYFTNRKLRERRIKLFGTKKTEIQSLLISTWNYTDANLQ 67
            |...||.|.:|.||...:                         ..|.|: .|:|:||.:.:|...
 Frog     4 APCICLVLFLLKLLACVV-------------------------EMKAEL-PLVINTWPFRNATEA 42

  Fly    68 AWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEAAIMDGESLEYGAVAGMN 132
            ||.||:.| .....||.:||..|:..:|...:....|||..|..||:|.||:|.::|.||||.:.
 Frog    43 AWRVLEAG-GSVLDAVEKGCAQCEIDQCDGSVGYGGSPDENGETTLDAMIMNGNTMEIGAVAQLR 106

  Fly   133 GVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNVLKKWRSNGCQPNFWRDV 197
            .::|||.||.||:::|||:.|||:||:.||.|:|:..|.||...:|::..||....||||:|::|
 Frog   107 RIKNAIGVARAVMEHTKHTFLVGESASLFAESMGFMREDLTTNHSRSIHSKWLDQSCQPNYWKNV 171

  Fly   198 HPSPAENCGPYSPLP--EHMHQHPMHQEYAIIQGQHDQLAFLALDAEGKFHVASQSSGAQFRIPG 260
            .|..:::||||.|..  ::..|.|:.|:..:  ..||.:..:|:|..|...|.:.::||..:|||
 Frog   172 VPDASKSCGPYHPFKGVKNEKQSPLQQKINV--HNHDTIGMIAIDKAGNVAVGTSTNGATHKIPG 234

  Fly   261 RVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAGKEPDKAAELVVQRLLRHNT 325
            |||||.:||||.|||:.||||.|:||||::||.||::.|||.||.|.:|..|.:..:.|:.::..
 Frog   235 RVGDSPIPGAGAYADSVVGGAAATGDGDIMMRFLPSYQAVEYMRMGSDPTAACQKAIGRIQKYFP 299

  Fly   326 EFNGAVVVVNRRGIYAAAC---AGLDEFHFVV 354
            .|.|||:..|..|.|.|||   .|..||||.|
 Frog   300 NFFGAVICANSTGSYGAACNKIPGFKEFHFTV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 132/306 (43%)
agaXP_002934303.3 Glycosylasparaginase 29..331 CDD:271335 131/304 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.