DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and PRSS27

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:260 Identity:93/260 - (35%)
Similarity:144/260 - (55%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFR--KERISVR 180
            ||...:..|:||||:|:..::||...:...|..:|..||:.:|::|||:||   ||  .|....:
Human    26 CGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHC---FRNTSETSLYQ 87

  Fly   181 LLEHDRKMSH--MQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF 243
            :|...|::..  ...:..:|.:|.::|.|.......|:|:::|:.||.|...:.|||:|.|...|
Human    88 VLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIF 152

  Fly   244 K-GENGIVTGWGALKVGGPTSD-------TLQEVQVPILSQDEC-----RKSRYG---NKITDNM 292
            : |.|..|||||:     |:.:       .||::.|||:...:|     :.:.:|   ..|.::|
Human   153 ETGMNCWVTGWGS-----PSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDM 212

  Fly   293 LCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNL 357
            ||.|::||.||:|:||||||| :...|....| |||:|||||||:...||||.||..:..||..:
Human   213 LCAGFEEGKKDACKGDSGGPL-VCLVGQSWLQ-AGVISWGEGCARQNRPGVYIRVTAHHNWIHRI 275

  Fly   358  357
            Human   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/247 (36%)
Tryp_SPc 127..356 CDD:238113 90/248 (36%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 89/247 (36%)
Tryp_SPc 36..275 CDD:238113 90/248 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.