DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss60.1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:250 Identity:92/250 - (36%)
Similarity:141/250 - (56%) Gaps:9/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGIANIQKRIVGGQETEVHQYPWVAML---LYGGRFYCAASLLNDQFLLTASHCVYGFRKERIS 178
            |||:|.:..|||||.......:||...|   :|||.| |..||:|.:::|||:||:.......:.
Zfish    24 VCGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHF-CGGSLINSEWVLTAAHCLPRITTSSLL 87

  Fly   179 VRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF 243
            |.|.:..::..:..:|:|.|:.:..||.||....:||||::.|...|.|:..:.|||:......|
Zfish    88 VFLGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVF 152

  Fly   244 -KGENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSC 305
             .|.:..:||||.:::|.  |....|||..:|::..|:|........:|:||:|.|..:||:|:|
Zfish   153 PNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVTNNMICAGLLQGGRDTC 217

  Fly   306 QGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360
            |||||||:  |:........:|:.|||.|||....||||.||::|.:||.::..|
Zfish   218 QGDSGGPM--VSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/233 (36%)
Tryp_SPc 127..356 CDD:238113 86/234 (37%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 85/233 (36%)
Tryp_SPc 34..267 CDD:238113 86/235 (37%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587867
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.