DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TPSAB1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:274 Identity:95/274 - (34%)
Similarity:142/274 - (51%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TRRATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRF---YCAASLL 157
            :|....|||              |.|..:..||||||....::||...|...|.:   :|..||:
Human    14 SRAYAAPAP--------------GQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLI 64

  Fly   158 NDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLD 222
            :.|::|||:|||....|:..::|:...::.:.:..:: ..|:.:|.||::.......|||:::|:
Human    65 HPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQL-LPVSRIIVHPQFYTAQIGADIALLELE 128

  Fly   223 EPVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDECRKSRY 284
            |||..:..:|.|.:|....:| .|....|||||.:....  |....|::|:|||:....| .::|
Human   129 EPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAKY 192

  Fly   285 ------GNK---ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGY 340
                  |:.   :.|:|||.|...  :|||||||||||....:||...  |||||||||||:...
Human   193 HLGAYTGDDVRIVRDDMLCAGNTR--RDSCQGDSGGPLVCKVNGTWLQ--AGVVSWGEGCAQPNR 253

  Fly   341 PGVYARVNRYGTWI 354
            ||:|.||..|..||
Human   254 PGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/242 (36%)
Tryp_SPc 127..356 CDD:238113 89/243 (37%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 89/243 (37%)
Tryp_SPc 31..267 CDD:214473 87/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.