DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss6

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:266 Identity:98/266 - (36%)
Similarity:157/266 - (59%) Gaps:18/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PTLNPPRNCSD------CVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLL 163
            |..:...:|.|      |.||:..:..|||||..:...::||.|.|...||..|..:|:.|::::
Mouse   549 PECDGQSDCRDGSDEQHCDCGLQGLSSRIVGGTVSSEGEWPWQASLQIRGRHICGGALIADRWVI 613

  Fly   164 TASHCVYGFRKERI-SVRL----LEHDRKMSHMQ-KIDRKVAEVITHPKYNARNYDNDIAIIKLD 222
            ||:||   |:::.: |.:|    |...|:.|... ::..||:.:..||.:...::|.|:|:::||
Mouse   614 TAAHC---FQEDSMASPKLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLD 675

  Fly   223 EPVEFNEVLHPVCMPTPGRSFK-GENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGN 286
            .||.::..:.|||:|.....|: |::..:|||||.:.|||.|:|||:|.|.::.||.|.:: |..
Mouse   676 HPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREGGPVSNTLQKVDVQLVPQDLCSEA-YRY 739

  Fly   287 KITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYG 351
            :::..|||.||.:|.||:||||||||| :....:....:||:||||.||.:..:.|||.||.|..
Mouse   740 QVSPRMLCAGYRKGKKDACQGDSGGPL-VCREPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVI 803

  Fly   352 TWIKNL 357
            .||:.:
Mouse   804 NWIQQV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/234 (38%)
Tryp_SPc 127..356 CDD:238113 91/235 (39%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 3/16 (19%)
Tryp_SPc 576..806 CDD:214473 90/234 (38%)
Tryp_SPc 577..809 CDD:238113 91/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8078
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.