DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TMPRSS2

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:309 Identity:103/309 - (33%)
Similarity:150/309 - (48%) Gaps:44/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSD-------CV-CGI---ANI 123
            ||..::.|:.||        |.....|..........|.....||.       |: ||:   ::.
Human   233 SSQGIVDDSGST--------SFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSR 289

  Fly   124 QKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKM 188
            |.|||||:......:||...|.......|..|::..::::||:|||         .:.|.:....
Human   290 QSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCV---------EKPLNNPWHW 345

  Fly   189 SHMQKIDR----------KVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF 243
            :....|.|          :|.:||:||.|:::..:||||::||.:|:.||:::.|||:|.||...
Human   346 TAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMML 410

  Fly   244 KGENGI-VTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR--YGNKITDNMLCGGYDEGGKDSC 305
            :.|... ::||||.:..|.||:.|...:|.::....| .||  |.|.||..|:|.|:.:|..|||
Human   411 QPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRC-NSRYVYDNLITPAMICAGFLQGNVDSC 474

  Fly   306 QGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            ||||||||  |.|......:.|..|||.|||||..||||..|..:..||
Human   475 QGDSGGPL--VTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/240 (36%)
Tryp_SPc 127..356 CDD:238113 88/241 (37%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 12/57 (21%)
Tryp_SPc 292..521 CDD:214473 87/240 (36%)
Tryp_SPc 293..524 CDD:238113 88/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.