DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss32

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:305 Identity:108/305 - (35%)
Similarity:148/305 - (48%) Gaps:44/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQET 133
            |..|.::|         |.:.|.||||.||:..            .|.|||......|||.||:.
Mouse    17 LLGSEVLP---------TDSDSPSTTTGRRSID------------LDSVCGRPRTSGRIVSGQDA 60

  Fly   134 EVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLL------EHDRKMSHMQ 192
            ::.::||...:...|...|..||:.:.::|||:||....:...|...||      ..|.:...: 
Mouse    61 QLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPEDNEPKEL- 124

  Fly   193 KIDRKVAEVITHPKYNARNYDN-DIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGA 255
               |.||:.|.||.|:|..:.: |||:::|..|:.||:.:.|||:|.||... .|....|||||.
Mouse   125 ---RAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGH 186

  Fly   256 LKVGGPTSD--TLQEVQVPILSQDECRKSRYGNK-------ITDNMLCGGYDEGGKDSCQGDSGG 311
            :....|...  ||||:|||::..:.|......|.       |.:.|||.|:.||.||:|.|||||
Mouse   187 IGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGG 251

  Fly   312 PLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            ||  |.........|||||||..||....||||..|:.|.:||:|
Mouse   252 PL--VCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/244 (37%)
Tryp_SPc 127..356 CDD:238113 91/245 (37%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 90/244 (37%)
Tryp_SPc 54..295 CDD:238113 92/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.