DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss56

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:334 Identity:109/334 - (32%)
Similarity:159/334 - (47%) Gaps:28/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VLSLLPQRPGSSDSENATLAT-LSSSSMMPDAASTTSTTTPAPSSSTTTTRRA------------ 99
            :|.||...|.|..:....|.| ||..::...:|..|.....|..|:....:|.            
Mouse     7 LLLLLLLSPDSQTAHGHPLYTRLSPGALQVLSAQGTQALQAAQRSAQWAIKRVLMEIQHRLHECQ 71

  Fly   100 -----TTPAPPTL-NPPR--NCSDCVCGIANIQK---RIVGGQETEVHQYPWVAMLLYGGRFYCA 153
                 ..|..|.| :||.  .|.:...|:||..:   |||||.......:||:..|..||...|.
Mouse    72 VGPGRPRPQAPLLQDPPEPVQCGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCG 136

  Fly   154 ASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAI 218
            ..|:...::|||:||..|...|.:...:|....:....:::  :|..::.|||::.:.:.||:|:
Mouse   137 GVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQAEEV--QVNRILPHPKFDPQTFHNDLAL 199

  Fly   219 IKLDEPVEFNEVLHPVCMPTPGRS-FKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKS 282
            ::|..||.......|:|:|...|. ..|....:.|||||...||.|:.::|.:||:||.|.|:|.
Mouse   200 VQLWTPVSPEGPARPICLPQGSREPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKV 264

  Fly   283 RYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIA-GVVSWGEGCAKAGYPGVYAR 346
            .........|||.||..||.|||||||||||.....|.|..::. ||.|||:||.:.|.||||.|
Mouse   265 LGPGLRPSTMLCAGYLAGGIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTR 329

  Fly   347 VNRYGTWIK 355
            |..:..|::
Mouse   330 VTVFKDWLQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/229 (37%)
Tryp_SPc 127..356 CDD:238113 85/231 (37%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm44284
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.