DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:232 Identity:89/232 - (38%)
Similarity:134/232 - (57%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSH 190
            :||||.|...:..|: .:.|..|..:|..||:::.::::|:||.    |.|:.|||.||:..::.
Zfish    24 KIVGGYECTKNGVPY-QVSLNSGYHFCGGSLISNLWVVSAAHCY----KSRVQVRLGEHNIDVTE 83

  Fly   191 MQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGA 255
            ..:......:||.||.||:...|||:.:|||....:.|..:..|.:|:...| .|.:.:::|||.
Zfish    84 GTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSSCAS-SGTSCLISGWGN 147

  Fly   256 LKVGGPT-SDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASG 319
            :...|.. ...|..:..||||...||.: |..:|:.||.|.|:.||||||||||||||  :|.: 
Zfish   148 MSASGSNYPSRLMCLNAPILSDSTCRNA-YPGQISSNMFCAGFMEGGKDSCQGDSGGP--VVCN- 208

  Fly   320 TREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
               :|:.|:||||.|||:...|||||:|..:.|||:|
Zfish   209 ---NQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 86/228 (38%)
Tryp_SPc 127..356 CDD:238113 88/229 (38%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 86/228 (38%)
Tryp_SPc 25..243 CDD:238113 89/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.