DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TMPRSS3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:237 Identity:94/237 - (39%)
Similarity:131/237 - (55%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGF---RKERISVRL--LEHD 185
            |||||..:.:.|:||.|.|.:.|...|..|::...:::||:||||..   :...|.|.|  |..:
Human   216 RIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDN 280

  Fly   186 RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGI 249
            ...||:      |.:::.|.||..:...||||::||..|:.|||::.|||:|....:| .|:...
Human   281 PAPSHL------VEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCW 339

  Fly   250 VTGWGALKVG-GPTSDTLQEVQVPILSQDEC-RKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGP 312
            .:||||.:.| |..|..|....||::|...| .:..||..|:.:|||.||..||.||||||||||
Human   340 TSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGP 404

  Fly   313 LHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            |  |....|..::.|..|:|.|||:...||||.||..:..||
Human   405 L--VCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 92/235 (39%)
Tryp_SPc 127..356 CDD:238113 93/236 (39%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133
Tryp_SPc 216..444 CDD:214473 92/235 (39%)
Tryp_SPc 217..447 CDD:238113 93/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.