DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG34458

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:233 Identity:75/233 - (32%)
Similarity:121/233 - (51%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKM 188
            :.||:|||.....|:|....|...||.:|..||::|..::||:||..|....::...:..:|...
  Fly    29 ESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSA 93

  Fly   189 SHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGEN-GIVTG 252
            .:.|..:  :|:.|.||:||.::.|.|:::|||..||.....:..:.:.....::..:. .:::|
  Fly    94 GNGQTFN--IAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISG 156

  Fly   253 WGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVA 317
            :||:.......:.|:..||.:.|:|.|....... :||.|:|.|:..|...||||||||||    
  Fly   157 FGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG-LTDRMVCAGHPSGQVSSCQGDSGGPL---- 216

  Fly   318 SGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
              |.:.::.||||||.||...|.|.:|..|....:|||
  Fly   217 --TVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 72/228 (32%)
Tryp_SPc 127..356 CDD:238113 74/230 (32%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 72/228 (32%)
Tryp_SPc 32..254 CDD:238113 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm25354
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.