DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss21

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:274 Identity:101/274 - (36%)
Similarity:147/274 - (53%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTAS 166
            |..|.|..|...|. .||...|..|||||.:.|:.::||...|...|...|.|:|||.:::|||:
Mouse    31 PEKPELQEPDLLSG-PCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAA 94

  Fly   167 HCVYGFRKER------ISVRLLEHDRKMSHMQKIDRK--VAEVITHPKYNARNYDNDIAIIKLDE 223
            ||   |:|:.      :....|.....:.::|....:  :.::...||| :..|.||||::||..
Mouse    95 HC---FQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKY-SEQYPNDIALLKLSS 155

  Fly   224 PVEFNEVLHPVCMPTPGRSFKGENGI---VTGWGALKVGG----PTSDTLQEVQVPILSQDEC-- 279
            ||.:|..:.|:|:  ...::|.||..   ||||||  :|.    |:.:|||||||.|::...|  
Mouse   156 PVTYNNFIQPICL--LNSTYKFENRTDCWVTGWGA--IGEDESLPSPNTLQEVQVAIINNSMCNH 216

  Fly   280 --RKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPG 342
              :|..:...|..:|:|.|..|||||:|.||||||| .....|..:|: ||||||.||.:...||
Mouse   217 MYKKPDFRTNIWGDMVCAGTPEGGKDACFGDSGGPL-ACDQDTVWYQV-GVVSWGIGCGRPNRPG 279

  Fly   343 VYARVNRYGTWIKN 356
            ||..::.:..||::
Mouse   280 VYTNISHHYNWIQS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 91/246 (37%)
Tryp_SPc 127..356 CDD:238113 92/247 (37%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 91/246 (37%)
Tryp_SPc 55..294 CDD:238113 92/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.