DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:257 Identity:91/257 - (35%)
Similarity:133/257 - (51%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGIAN--IQKRIVGGQETEVHQYPWVAMLLYGGRF--YCAASLLNDQFLLTASHCVYGFRKERI 177
            |||..|  :..|||||.......:||:..|  .||:  :|..||:|:|::|||:||:.......|
Zfish    24 VCGRPNPTLNPRIVGGVNATHGAWPWMVSL--QGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSI 86

  Fly   178 SVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS 242
            .|.|.:....::.:..|.|.:..:|.||.|:....|||||:::|...|::.:.:.|:|:.....:
Zfish    87 IVYLGKWRSYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSN 151

  Fly   243 F-KGENGIVTGW---GALKVGG-----------PTSDTLQEVQVPILSQDECRKSRYGNKITDNM 292
            | :|.|..|.||   |.|..||           |....|||.::.:.|..:|....:| :||.||
Zfish   152 FPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHG-RITPNM 215

  Fly   293 LCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            :|.|...|||.:..|||||||....|...:   |||:|.|.|||:...|.|:.||:.|..||
Zfish   216 ICAGTRPGGKATFSGDSGGPLMTKCSVWVQ---AGVLSHGYGCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/244 (35%)
Tryp_SPc 127..356 CDD:238113 86/245 (35%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.