DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and PRSS3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:305 Identity:113/305 - (37%)
Similarity:157/305 - (51%) Gaps:39/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PDAASTTSTTTPAPSSSTTTTRRA--TTPAPPTLN------------------PPRNCSDCVCGI 120
            |.||..:..|..|..:.....|.|  :|...|..|                  |.||.::  .|:
Human    38 PGAAPASGWTHLASGAGCRRLRGAGHSTQKNPVFNWLIWKILERERHRGSDYLPIRNQNE--LGV 100

  Fly   121 A---NIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLL 182
            |   :...:||||...|.:..|:...|..|..| |..||:::|::::|:||.    |.||.|||.
Human   101 AVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHF-CGGSLISEQWVVSAAHCY----KTRIQVRLG 160

  Fly   183 EHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGEN 247
            ||:.|:....:.....|::|.|||||....||||.:|||..|...|..:..:.:||...: .|..
Human   161 EHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPA-AGTE 224

  Fly   248 GIVTGWG-ALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGG 311
            .:::||| .|..|....|.|:.:..|:|:|.|| |:.|..|||::|.|.|:.||||||||.||||
Human   225 CLISGWGNTLSFGADYPDELKCLDAPVLTQAEC-KASYPGKITNSMFCVGFLEGGKDSCQRDSGG 288

  Fly   312 PLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            |  :|.:|    |:.||||||.|||....||||.:|..|..|||:
Human   289 P--VVCNG----QLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 95/228 (42%)
Tryp_SPc 127..356 CDD:238113 97/229 (42%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 95/228 (42%)
Tryp_SPc 110..328 CDD:238113 98/231 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.