DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and zgc:112285

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:290 Identity:87/290 - (30%)
Similarity:138/290 - (47%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RATTPAPPTLNPPRNCSDCV--------CGIA----NIQKRIVGGQETEVHQYPWVAMLLY---G 147
            ||:|.|   .||.|.....:        ||:|    |..:|||.|.|...|.:||...|..   |
Zfish    21 RASTHA---FNPSRLQQHKILHLDWPKDCGLAHFKPNTVERIVSGNEARPHSWPWQVSLQVRPRG 82

  Fly   148 GRFY---CAASLLNDQFLLTASHCVYGFRKERIS---VRLLEHDRKMSHMQKIDRKVAEVITHP- 205
            .:.|   |..:|::..::|||:||....:.|..|   :.|.:|..|.|...:....|..:..|. 
Zfish    83 SKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLGKHQLKRSETAERFFPVKRIYRHEH 147

  Fly   206 -KYNARN-YDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFK-GENGIVTGWGALKVGGPT---SD 264
             :|.|.: .|.|||::|....::.:..:...|:|....:.. |....|||||..:.|...   ::
Zfish   148 FRYPAHSELDYDIALVKAATDIQPSNFIRYACLPRKQINLNPGHYCWVTGWGDTRGGKENVSLAE 212

  Fly   265 TLQEVQVPILSQDECRKSRY-GNKITDNMLCGGY--DEGGKDSCQGDSGGPLHIVASGTREHQIA 326
            .|.:.::||:....||:.:: |:::.|:|:|.|:  .||...:||||||||| :...|....::.
Zfish   213 ALNQARLPIIDYKTCRQKKFWGDRVRDSMICAGFRDTEGTPAACQGDSGGPL-LCQVGRDRWEVH 276

  Fly   327 GVVSWGE-GCAKAGYPGVYARVNRYGTWIK 355
            |:||:|. ||.....|.|:.|...|..||:
Zfish   277 GIVSFGPIGCTVENKPSVFTRTAAYIPWIE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 74/247 (30%)
Tryp_SPc 127..356 CDD:238113 75/249 (30%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 74/247 (30%)
Tryp_SPc 59..308 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.