DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and LOC548809

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:268 Identity:95/268 - (35%)
Similarity:141/268 - (52%) Gaps:18/268 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 APPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASH 167
            |.||::.....|..:||...:..|||||.:.....:||...|.|.|...|..|::::|:::||:|
 Frog    34 ASPTVSQNTTASPRICGSPLVSSRIVGGTDATNGAWPWQISLRYKGSHICGGSVISNQWIMTAAH 98

  Fly   168 CV-YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVL 231
            |. |........|.|..:...::...::...||.||.:|.:.......|||::||..||.:.|.:
 Frog    99 CFEYSRTPSDYQVLLGAYQLSVASASELLSSVARVIVNPSFTIPGGPGDIALLKLTSPVAYTEYI 163

  Fly   232 HPVCMPTPGRSF-KGENGIVTGWGALKVGG----PTSDTLQEVQVPILSQDECRKSRY-GNKITD 290
            .|||:|:....| :|....|||||  .:|.    |...|||:|..|::|...|.:..: .:.|:.
 Frog   164 LPVCVPSSASGFYEGMQCWVTGWG--NIGSAVTLPYPQTLQQVMTPLISWSTCNQMYHVQSGISS 226

  Fly   291 NM-------LCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVN 348
            |:       :|.||..|.||||||||||||.....|. .:|| |:||||:|||:|..||||..|.
 Frog   227 NIAIVPKDQICAGYAAGQKDSCQGDSGGPLVCQLQGV-WYQI-GIVSWGDGCAQASRPGVYTLVP 289

  Fly   349 RYGTWIKN 356
            .:.:|:.:
 Frog   290 NFKSWLSS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 88/241 (37%)
Tryp_SPc 127..356 CDD:238113 88/242 (36%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 88/240 (37%)
Tryp_SPc 58..297 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.