DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss60.2

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:253 Identity:96/253 - (37%)
Similarity:141/253 - (55%) Gaps:15/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGIANIQKRIVGGQETEVHQYPWVAML---LYGGRFYCAASLLNDQFLLTASHCVYGFRKERIS 178
            |||.|.:..|||||.......:||...|   .|||.| |..||::.:::|||:||:.|..:..:.
Zfish    24 VCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHF-CGGSLISSEWVLTAAHCLPGVSESSLV 87

  Fly   179 VRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF 243
            |.|....::..:..:..|.||::|.|..||:...|||||:::|...|.||:.:.|||:......:
Zfish    88 VYLGRRTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVY 152

  Fly   244 K-GENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSC 305
            . |.:..:||||.::.|.  |....|||..:|:::.|.|........:|:||:|.|..:||||:|
Zfish   153 SAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQLGSGTVTNNMICAGLAKGGKDTC 217

  Fly   306 QGDSGGPLHIVASGTREHQI---AGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360
            |||||||:     .||...:   ||:.|||.|||....||||.||::|.:||.:...|
Zfish   218 QGDSGGPM-----VTRLCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/236 (38%)
Tryp_SPc 127..356 CDD:238113 90/237 (38%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 89/236 (38%)
Tryp_SPc 34..267 CDD:238113 90/238 (38%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587865
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.