DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and PLAT

DIOPT Version :10

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:268 Identity:81/268 - (30%)
Similarity:129/268 - (48%) Gaps:27/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 NCSDCVCGI---ANIQKRIVGGQETEVHQYPWVAMLLY------GGRFYCAASLLNDQFLLTASH 167
            :||  .||:   :..|.||.||...::..:||.|.:..      |.||.|...|::..::|:|:|
Human   295 SCS--TCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAH 357

  Fly   168 CVY-GFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEP----VEF 227
            |.. .|....::|.|....|.:...::...:|.:.|.|.:::...||||||:::|...    .:.
Human   358 CFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQE 422

  Fly   228 NEVLHPVCMPTPGRSFKGENGI-VTGWGALKVGGP-TSDTLQEVQVPILSQDECRKSRYGNK-IT 289
            :.|:..||:|............ ::|:|..:...| .|:.|:|..|.:.....|......|: :|
Human   423 SSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVT 487

  Fly   290 DNMLCGGYDEGG------KDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVN 348
            |||||.|....|      .|:|||||||||..:..|  ...:.|::|||.||.:...||||.:|.
Human   488 DNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDG--RMTLVGIISWGLGCGQKDVPGVYTKVT 550

  Fly   349 RYGTWIKN 356
            .|..||::
Human   551 NYLDWIRD 558

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113 75/248 (30%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967
KR 125..209 CDD:238056