DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss2

DIOPT Version :10

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:71 Identity:18/71 - (25%)
Similarity:32/71 - (45%) Gaps:16/71 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 IECVDPVALQFIIDAFRNQVYSLSTHPYGCRVIQRILEHCTPEQTAPILAELHANTEHLIQDQYG 618
            :|| ||...||::       |...|...|.:.|.:.|:    :....||||:    ..::|::.|
Mouse    10 VEC-DPAMKQFLL-------YLDETSALGKKFIIQDLD----DTHVFILAEV----VQILQERVG 58

  Fly   619 NYVIQH 624
            ..:.|:
Mouse    59 ELMDQN 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:464747
Tryp_SPc 254..485 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.