DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss33

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:259 Identity:96/259 - (37%)
Similarity:130/259 - (50%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DC-VCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRK---- 174
            :| .||...:..|||||::.:..::||...:.:.|...|..||:..|::|||.||   |.:    
  Rat    21 ECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHC---FSRRVLP 82

  Fly   175 ERISVRL--LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMP 237
            ...||.|  |..|...||...:  .|..|:..|.|:......|:|:::|..||..:..:.|||:|
  Rat    83 SEYSVLLGALSLDVTSSHELLV--PVLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPVCLP 145

  Fly   238 TPG-RSFKGENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDEC-RKSRYGNKITDN------- 291
            .|| ....|....|||||:|..|.  |....||.|:||:|....| |....|..:..:       
  Rat   146 APGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERIVLPG 210

  Fly   292 MLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
            .||.||..|.||:|||||||||..:.||  ...:.||||||:|||....||||..|.:|..||:
  Rat   211 NLCAGYRRGHKDACQGDSGGPLTCMESG--RWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 91/244 (37%)
Tryp_SPc 127..356 CDD:238113 92/246 (37%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 91/244 (37%)
Tryp_SPc 34..272 CDD:238113 91/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.