DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss27

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:261 Identity:87/261 - (33%)
Similarity:134/261 - (51%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV-YGFRKERISVRL 181
            ||......|||||......::||...::|.....|..||::..::::|:||. ..::.|.:.|.|
 Frog   411 CGQPAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSSNWVVSAAHCFPRSYKIENMQVLL 475

  Fly   182 -------LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTP 239
                   |..|       .:..:|..|||:|.|.......|||:::::.||.::..:.|:|:|..
 Frog   476 GCFALMNLTSD-------AVIIRVKRVITYPLYTGEGSSGDIAMVEMESPVTYSSYILPICIPLT 533

  Fly   240 GRSF-KGENGIVTGWGALKVGGPTSDT-------LQEVQVPILSQDECRKSRYGNK--------I 288
            ...| .|:...|||||.::     ||.       ||||:||:::...|....:.|.        :
 Frog   534 NEDFPSGKMCWVTGWGNIQ-----SDVSLSPPYPLQEVEVPLVNASSCDTMYHYNSDLNPATQLV 593

  Fly   289 TDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTW 353
            .|:|:|.||.||.||:||||||||| ...||.... :.|:||||:|||:...||||.:|:.:.:|
 Frog   594 HDDMICAGYPEGQKDACQGDSGGPL-ACKSGNYWF-LTGIVSWGDGCAQPNRPGVYTKVSSFSSW 656

  Fly   354 I 354
            |
 Frog   657 I 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 83/251 (33%)
Tryp_SPc 127..356 CDD:238113 84/252 (33%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 84/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.