DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and deltaTry

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:251 Identity:86/251 - (34%)
Similarity:125/251 - (49%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 CVCG-------IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFR 173
            |..|       :..:..|||||..|.:..:||...|...|...|..|:.:...::||:||:    
  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL---- 73

  Fly   174 KERISVRLLEHDRKMSHMQK--IDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM 236
             :.:|..:|:.....|:...  :...|:....|..|||....|||||||::..:.|:..:..:.:
  Fly    74 -QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL 137

  Fly   237 PTPGRSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKSR--YGNKITDNMLCGGYD 298
            .:...: .|....|:|||.|..|..: ...||.|.|.|:||.:|..|.  ||::|...|:|..  
  Fly   138 ASSNPA-NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-- 199

  Fly   299 EGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            ..|||:|||||||||  |:.|.    :.||||||.|||.:.||||||.|....:|:
  Fly   200 ASGKDACQGDSGGPL--VSGGV----LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 83/232 (36%)
Tryp_SPc 127..356 CDD:238113 83/233 (36%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 83/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.