DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and zgc:92590

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:231 Identity:100/231 - (43%)
Similarity:141/231 - (61%) Gaps:12/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLY-GGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMS 189
            :|:||.|...:..||...|.| .|:.:|.|||:||::.::|:||.  ....|::|.|.||:..:.
Zfish    20 KIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCY--LVANRLTVHLGEHNVAVE 82

  Fly   190 HMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWG 254
            ...:...|..:||.|||||....|||..:|||.||..||:.:.||.: |...|.:||..:|:|||
Zfish    83 EGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPL-TTSCSSEGEQCLVSGWG 146

  Fly   255 AL-KVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVAS 318
            .| ..|....|.||.:.:|:|::.:| :..||.:||.||.|.|:.|||||:||||||||  ::.:
Zfish   147 NLINTGVVYPDVLQCLNLPVLTRAQC-EGAYGWQITKNMFCAGFMEGGKDACQGDSGGP--VICN 208

  Fly   319 GTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            |    ::.||||||.|||.:||||||..|.||..|:
Zfish   209 G----ELRGVVSWGYGCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 99/229 (43%)
Tryp_SPc 127..356 CDD:238113 100/230 (43%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 99/229 (43%)
Tryp_SPc 21..243 CDD:238113 100/230 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.