DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Gm5771

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:235 Identity:97/235 - (41%)
Similarity:136/235 - (57%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSH 190
            :||||.....:..|: .:.|..|..:|..||:|||::::|:||.    |.||.|||.||:.|:..
Mouse    22 KIVGGYTCRENSVPY-QVSLNSGYHFCGGSLINDQWVVSAAHCY----KTRIQVRLGEHNIKVLE 81

  Fly   191 MQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPT---PGRSFKGENGIVTG 252
            ..:.....|::|.||.:|.:..:|||.:|||..||..|..:..|.:|:   |.    |...:::|
Mouse    82 GNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAPA----GTQCLISG 142

  Fly   253 WG-ALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIV 316
            || .|..|....|.||.:..|:|.|.:|..| |..|||.||:|.|:.||||||||||||||  :|
Mouse   143 WGNTLSFGVSEPDLLQCLDAPLLPQADCEAS-YPGKITGNMVCAGFLEGGKDSCQGDSGGP--VV 204

  Fly   317 ASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            .:|    ::.|:||||.|||.|..||||.:|..|..||::
Mouse   205 CNG----ELQGIVSWGYGCALADNPGVYTKVCNYVDWIQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 95/231 (41%)
Tryp_SPc 127..356 CDD:238113 97/232 (42%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 95/231 (41%)
Tryp_SPc 23..241 CDD:238113 97/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.