DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Try10

DIOPT Version :10

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:44 Identity:13/44 - (29%)
Similarity:19/44 - (43%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 NLAIPQQ-QSQPRRPLTPSQQGAENQPYQVISAYYDQSGSLVMG 184
            |..|.:| |.:.||.:..|..|   :|...:...:..||.|..|
Mouse     9 NCCIAEQPQPKRRRRIDRSMIG---EPTNFVHTAHVGSGDLFTG 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113 13/44 (30%)
Try10NP_001034085.1 Tryp_SPc 24..242 CDD:238113 7/29 (24%)

Return to query results.
Submit another query.