DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG9737

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:315 Identity:101/315 - (32%)
Similarity:153/315 - (48%) Gaps:56/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RRATTPAPPT----LNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFY-CAASL 156
            ||..|..|.:    ||.        || ..:..||.||:..|:.::||:|:|:|....| |:.:|
  Fly   125 RRIQTVEPSSGFNLLNE--------CG-KQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGAL 180

  Fly   157 LNDQFLLTASHCVYG----FRKERISVRLLEHDRKM--------SHMQ----KIDRKVAEVITHP 205
            ::|:.:|||:|||.|    .|:....|||.|.:.|.        :::.    .:|....::..||
  Fly   181 IDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHP 245

  Fly   206 KYNA-RNYD-NDIAIIKLDEPVEFNEVLHPVCMPT---PGRSFKGENGIVTGWGA--------LK 257
            :|.. .||. ||||||:|..||.|...:.|:|:|.   |....:|:...|:|||.        :.
  Fly   246 EYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFIN 310

  Fly   258 VGGPTSDTLQEVQVPILSQDECRK--SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGT 320
            :..|..   .::::|.:|.:.|.|  ..:|.::....:|.| .|..||:|.|||||||...   .
  Fly   311 IHSPIK---LKLRIPYVSNENCTKILEGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYF---D 368

  Fly   321 REHQ--IA-GVVSWG-EGCAKAGYPGVYARVNRYGTWIKNLTKQACLCQQETKKI 371
            |:|.  :| ||||:| ..|..||.|.||..|..|..||.::.:|....||...|:
  Fly   369 RQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKSQQTQDKM 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/263 (33%)
Tryp_SPc 127..356 CDD:238113 88/264 (33%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 87/263 (33%)
Tryp_SPc 150..409 CDD:238113 88/265 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.