DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss11c

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:259 Identity:88/259 - (33%)
Similarity:131/259 - (50%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIANIQKR---IVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV---------- 169
            ||...|..|   :.|||:.|..::||.|.|.......|.|:|:::.:|:||:||.          
Mouse   188 CGRRTIIHRGHKVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCFIRAANPKDWK 252

  Fly   170 --YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLH 232
              :||               :....:..|.|..:|.|..|:...:|||||:::|..||.:...:.
Mouse   253 VSFGF---------------LLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIR 302

  Fly   233 PVCMPTPGRSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR-YGNKITDNMLCG 295
            ..|:|...:.| ...:.:|||||.||..|.:.:.||:.:|.|:....|...: ||..||..|:|.
Mouse   303 RACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAYGGMITPGMMCA 367

  Fly   296 GYDEGGKDSCQGDSGGPLHIVASGTRE-HQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            |:.:|..|:|||||||||  |:..::. ..:||:||||:.||....||||.||..|..||.:.|
Mouse   368 GFLKGRVDACQGDSGGPL--VSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWITSKT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 82/245 (33%)
Tryp_SPc 127..356 CDD:238113 83/243 (34%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 81/242 (33%)
Tryp_SPc 200..428 CDD:238113 83/244 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.