DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and aqrs

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:234 Identity:46/234 - (19%)
Similarity:87/234 - (37%) Gaps:49/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHC--------VYGFRKERISV 179
            :|||:......::..|   ..:|..|...||.:|::.:.::|::||        :|.:..:.:|:
  Fly    63 VQKRLPFDATRDLTYY---VNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSI 124

  Fly   180 RL-LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEV----LHPVCMPTP 239
            .. :|.|......|.|.      ...|......:.|.:|::.|...::.::.    ||.. .|..
  Fly   125 LTGVELDDNPEPHQVIG------FFMPVNKNERFTNYVALLALSNKLDRDKYRYIPLHRK-KPQA 182

  Fly   240 GRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNK-------ITDNMLC-GG 296
            |...|           :...||....::.....::..|.| |..||.|       ...:.:| ..
  Fly   183 GDDVK-----------MAYYGPPKFQIRLYNTRVMDIDRC-KIHYGLKEVFHVSTFEPDFICVRN 235

  Fly   297 YDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGC 335
            .....|.:|....|.||.|      ::::|.:..:||.|
  Fly   236 KRHSKKTTCSTRPGDPLLI------DNKLAAINIYGEHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 44/231 (19%)
Tryp_SPc 127..356 CDD:238113 43/230 (19%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 42/212 (20%)
Tryp_SPc 83..268 CDD:304450 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.