DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG11836

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:256 Identity:114/256 - (44%)
Similarity:167/256 - (65%) Gaps:7/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKE 175
            :|| ||.||.:|.:.|||||:.|.|:||||:|.::|.|:|:|..|||...::|:|:|||...||.
  Fly    82 KNC-DCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKS 145

  Fly   176 RISVRLLEHDRKM-SHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTP 239
            :|.|...:||::: |..|.|.|.|..||.|..::...|:||||:::|.:|:.|::::.|:|:|..
  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY 210

  Fly   240 GRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRY-GNKITDNMLCGGYDEGGKD 303
            .....|..|.|.|||....||.....:.:|:|||:|..|||..|| ..:||.:|||.|  ....|
  Fly   211 NYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMD 273

  Fly   304 SCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQACLC 364
            |||||||||| ::::|.: :.|.|:||||.||.:.||||||:||:::..|||:..:..|||
  Fly   274 SCQGDSGGPL-LLSNGVK-YFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLENTCLC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 101/229 (44%)
Tryp_SPc 127..356 CDD:238113 102/230 (44%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 103/231 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471769
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
109.900

Return to query results.
Submit another query.