DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG7432

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:382 Identity:127/382 - (33%)
Similarity:177/382 - (46%) Gaps:75/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CGPSQSASQDRATNQTAASPLLKQSQNTFIQWVLSLLPQRPGSSDSENATLATLSSSSMMPDAAS 80
            |.|..|:|    |..|...||              .|..||        |..|.::.:..|...|
  Fly   376 CCPISSSS----TVLTTQKPL--------------RLTTRP--------TTTTSTTKATQPTKKS 414

  Fly    81 TTSTTT-----------PAPSSSTTTTRRATTPAPPTLNPP------RNCSD-CVCGIANIQK-R 126
            |...||           ..|.::||||   ||..|  |.|.      .|..| ..||...... |
  Fly   415 TVRPTTRPTSGLVLIPQKKPPTTTTTT---TTEVP--LEPEGLDEIGNNIVDPDECGQQEYSTGR 474

  Fly   127 IVGGQETEVHQYPWVAMLLYGG----RFYCAASLLNDQFLLTASHCVYGFRKE-----RISVRL- 181
            ||||.|....|:||:|.:...|    .|:|..||:..:::|||:||....|::     :.:||| 
  Fly   475 IVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLG 539

  Fly   182 ---LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMP-----T 238
               |..|.:.|  ..:...|.||.||.:::...:.|||||:.||:||..::.:.|||:|     .
  Fly   540 DIDLSTDAEPS--DPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMP 602

  Fly   239 PGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKD 303
            |.....|....|.|||....||..|.:.::.::||...::|.:| |...|.:|.:|.||.:||.|
  Fly   603 PKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRS-YFQPINENFICAGYSDGGVD 666

  Fly   304 SCQGDSGGPLHIVASGTREHQI-AGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTK 359
            :|||||||||.:...   .|.: .||||:|..|.:.||||||.||..|..||::.|:
  Fly   667 ACQGDSGGPLMMRYD---SHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRDHTR 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 92/246 (37%)
Tryp_SPc 127..356 CDD:238113 93/247 (38%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 1/1 (100%)
Tryp_SPc 474..715 CDD:214473 92/246 (37%)
Tryp_SPc 475..718 CDD:238113 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.