DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG7142

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:338 Identity:91/338 - (26%)
Similarity:145/338 - (42%) Gaps:62/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LATLSSSSMMPDAASTTSTTTPAPSSSTTTTRR---------ATTPAP------------PTLNP 109
            |:|::|..::..:||:.|...|       |.|:         |.|.|.            .||..
  Fly    13 LSTIASIMVVLSSASSGSIQLP-------TVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEA 70

  Fly   110 PRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLL-----YGGRFYCAASLLNDQFLLTASHCV 169
            ||.        .:..|:.:..:|...|..|:|..:.     .|...|||.:::|:.::|||:||:
  Fly    71 PRQ--------THWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCL 127

  Fly   170 YGFRKERISVRLLE----HDRK--MSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFN 228
            ...:....||.:..    ||:|  .|::|.  |.:...:.|..|.......|||:|...||:.|:
  Fly   128 SSPQAVENSVIVAGSHDIHDQKGEASNIQM--RHIDYYVRHELYLGGVNPYDIALIYTKEPLVFD 190

  Fly   229 EVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTS--DTLQEVQVPILSQDECRK--SRYGNKIT 289
            ..:.|..:|......:| .|.:.|||.:.:....:  ..|||..:|||..:.|.:  :|.|..:.
  Fly   191 TYVQPATLPEQDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLH 254

  Fly   290 DNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREH-----QIAGVVSWGE-GCAKAGYPGVYARVN 348
            :..||.|...||...|..||||||  :.....||     .:.|:||||: .|.:...|.|:.||:
  Fly   255 ETNLCTGPLTGGVSICTADSGGPL--IQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVS 317

  Fly   349 RYGTWIKNLTKQA 361
            .:..||..:...|
  Fly   318 AFTEWINQVISTA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 71/248 (29%)
Tryp_SPc 127..356 CDD:238113 73/249 (29%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/246 (30%)
Tryp_SPc 84..323 CDD:214473 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.