DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG31266

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:298 Identity:79/298 - (26%)
Similarity:125/298 - (41%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQK----------RIVGGQETEVHQYP 139
            |..|....|...|....|.|              |:|||::          |::||.......:|
  Fly    14 TLLALQGPTEAMRMRGEPLP--------------GLANIERHRSTEAVPQGRVIGGTTAAEGNWP 64

  Fly   140 WVAMLLYGGRFY-CAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKID-------- 195
            |:|.:.....:: |.|.:|::.::|||:.||.|.|...:.|          ....:|        
  Fly    65 WIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLV----------VTGTVDWWDLYAPY 119

  Fly   196 RKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGG 260
            ..|:::..|..::...|.||||:::|...:|||:|...:.:.......:|:.....|||:.:..|
  Fly   120 YTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMG 184

  Fly   261 PTSDTLQEVQVPILSQDECRKSRYGNKITD-NMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQ 324
            .....|||.....|..|.||:........| ..:|...| .|:.:|.||:||||.     ..:.:
  Fly   185 TYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMD-AGQGACHGDTGGPLI-----DEQQR 243

  Fly   325 IAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQAC 362
            :.|:.:||..|.: |||.||||...|..||:. |...|
  Fly   244 LVGIGNWGVPCGR-GYPDVYARTAFYHDWIRT-TMNGC 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 65/237 (27%)
Tryp_SPc 127..356 CDD:238113 66/238 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/237 (27%)
Tryp_SPc 52..275 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.