DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG10405

DIOPT Version :10

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:119 Identity:27/119 - (22%)
Similarity:45/119 - (37%) Gaps:38/119 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   756 SGNAAAASATGTAANGTAGSAAGGPATNGT-------NGSANST-TGELTANGPSNGA------- 805
            :||:.:.|.|      |.|||...|....:       ..:..|| :..:..||.||.|       
  Fly    50 NGNSTSRSTT------TIGSAGPTPIIKKSFRDLLPPPPALRSTFSPRIMENGHSNLAHKQHIND 108

  Fly   806 GVSNGGGNANGAGATATV---------------GSSASNGAGVPSNGVTTNSNT 844
            .:.|  |||:...::..:               ||..|:|...|.:.:.|:|::
  Fly   109 DIDN--GNADDERSSREINRQWISTDWKHRTDLGSDGSSGVESPPSDLPTSSSS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 27/119 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.