DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG3916

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:119/270 - (44%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SDCVCGIANIQKRIVGGQE-TEVHQYPWVAMLLYGGRF--YCAASLLNDQFLLTASHCVYGFRKE 175
            :|.|........||.|||. .|...:.....:...||:  :|..|:::.|.:|||:||:...:.|
  Fly    18 ADVVTSTTESPTRINGGQRVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVE 82

  Fly   176 RISVRL---------LEHDRKMSHMQKIDRKVAEVITHPKYNAR-NYDNDIAIIKLDEPV----- 225
            .:||.:         |.|.....|:            ||:|:.. ...||||::|:..|.     
  Fly    83 DVSVVVGTLNWKAGGLRHRLVTKHV------------HPQYSMNPRIINDIALVKVTPPFRLERS 135

  Fly   226 EFNEVLHPVCMPTPGRSFKGENGIV--TGWGALKVGGPTS---DTLQEVQVPILSQDECRKSRYG 285
            :.:.:|      ..|....||...|  ||||:......::   |.||.:....:|.::|.:.  |
  Fly   136 DISTIL------IGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQK--G 192

  Fly   286 NKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRY 350
            .::|.|.:| .....|:.:|.|||||||  :..|.:.| :.|:||:|......|.|.||.||:.:
  Fly   193 FRVTRNEIC-ALAVQGQGACVGDSGGPL--IRPGKQPH-LVGIVSYGSSTCAQGRPDVYTRVSSF 253

  Fly   351 GTWIKNLTKQ 360
            ..:|..:..|
  Fly   254 LPYISQVINQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 70/250 (28%)
Tryp_SPc 127..356 CDD:238113 70/251 (28%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 70/250 (28%)
Tryp_SPc 31..260 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.