DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss11c

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:259 Identity:87/259 - (33%)
Similarity:131/259 - (50%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIANIQ---KRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV---------- 169
            ||...|.   .::.|||:.|..::||.|.|.......|.|:|:::.:|:||:||.          
  Rat   175 CGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWK 239

  Fly   170 --YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLH 232
              :||               :....:..|.|..::.|..|:...::||||:::|..||.:...:.
  Rat   240 VSFGF---------------LLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIR 289

  Fly   233 PVCMPTPGRSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR-YGNKITDNMLCG 295
            ..|:|...:.| ...:.:|||||.||..|.:.:.||:.:|.|:....|...: ||..||..|||.
  Rat   290 RACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCA 354

  Fly   296 GYDEGGKDSCQGDSGGPLHIVASGTRE-HQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            |:.||..|:|||||||||  |:..::. ..:||:||||:.||....||||.||..|..||.:.|
  Rat   355 GFLEGRVDACQGDSGGPL--VSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 81/242 (33%)
Tryp_SPc 127..356 CDD:238113 83/243 (34%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 81/242 (33%)
Tryp_SPc 187..415 CDD:238113 83/244 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.