DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss29

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:257 Identity:95/257 - (36%)
Similarity:137/257 - (53%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRK 187
            :.||||||.::|..::||...|.:.|.|.|..|||.|.::|||:||.......:.:..|..:  :
 Frog    22 MSKRIVGGTDSEEGEWPWQISLEFEGGFLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYLGVY--Q 84

  Fly   188 MSHMQK-IDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGIV 250
            :|.:.. :.|.|..:..||.|.......|||:|:|:||:.|...:.|||:|:..... .|....|
 Frog    85 LSDLDNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLPSQDVPLPMGTMCWV 149

  Fly   251 TGWGALKVGGPTSD--TLQEVQVPILSQDECR---KSRYGNK-----ITDNMLCGGYDEGGKDSC 305
            ||||.:|...|..|  |||:.:|.::::..|.   :|..|.:     |.|:|:|.||.:|..|:|
 Frog   150 TGWGNIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDDMICAGYKQGKIDAC 214

  Fly   306 QGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQACLCQQE 367
            ||||||||  |.:.:......|:||||.|||:...||||..|..|.|||:.|......|..|
 Frog   215 QGDSGGPL--VCNTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQYYLTWIQELVPSVMFCDGE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/239 (37%)
Tryp_SPc 127..356 CDD:238113 90/240 (38%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.