DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and mas

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:245 Identity:85/245 - (34%)
Similarity:135/245 - (55%) Gaps:18/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPW-VAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRK--ERISVRLLEHD-- 185
            |:|||::.|..::.| ||::....::.|.|:|:..|::|||:|||....:  :.|.||:.::|  
  Fly   802 RVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLT 866

  Fly   186 RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGI 249
            ||.........:||....|..:|::..|||||::||....|..:.:..||:|..|.|. .|:...
  Fly   867 RKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCT 931

  Fly   250 VTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNM-------LCGGYDEGGKDSCQG 307
            |||:|.:...||....::|.::||:|..||  .|..|.:|:.:       .|.|.:| |.|:|||
  Fly   932 VTGYGYMGEAGPIPLRVREAEIPIVSDTEC--IRKVNAVTEKIFILPASSFCAGGEE-GHDACQG 993

  Fly   308 DSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNL 357
            |.||||  |......:::||:||||.||.:...||||.:.:.:..||..:
  Fly   994 DGGGPL--VCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQI 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 83/240 (35%)
Tryp_SPc 127..356 CDD:238113 84/241 (35%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.