DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and KLKB1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:260 Identity:97/260 - (37%)
Similarity:140/260 - (53%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RNCS---DCVCGIANIQKRIVGGQETEVHQYPWVAML---LYGGRFYCAASLLNDQFLLTASHCV 169
            |.|:   :.|| ......|||||..:...::||...|   |...|..|..||:..|::|||:||.
Human   384 RLCNTGDNSVC-TTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCF 447

  Fly   170 YGFRKERISVRLLEHDRKMSHMQKID--RKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLH 232
            .|...:.: .|:......:|.:.|..  .::.|:|.|..|.....::|||:|||..|:.:.|...
Human   448 DGLPLQDV-WRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQK 511

  Fly   233 PVCMPTPG-RSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGG 296
            |:|:|:.| .|....|..|||||..|..|...:.||:|.:|:::.:||:|.....|||..|:|.|
Human   512 PICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAG 576

  Fly   297 YDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQA 361
            |.|||||:|:|||||||  |.......::.|:.|||||||:...||||.:|..|..||...|:.:
Human   577 YKEGGKDACKGDSGGPL--VCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSS 639

  Fly   362  361
            Human   640  639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/233 (39%)
Tryp_SPc 127..356 CDD:238113 91/234 (39%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519 1/1 (100%)
Tryp_SPc 401..632 CDD:214473 90/233 (39%)
Tryp_SPc 402..632 CDD:238113 89/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.