DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG30414

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:284 Identity:78/284 - (27%)
Similarity:122/284 - (42%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PRNCSDCVCGIANIQ--KRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV--- 169
            |.:..|..||....:  ..|.||.:..:...||:..:|  |...|..||:..:|:|||:||:   
  Fly    22 PGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVST 84

  Fly   170 -----YGFRKERI----------------SVRLLEHDRKM---------SHMQKIDRKVAEVITH 204
                 .|..|.|.                .:||.|:|.:.         |:...:|||    |.|
  Fly    85 HMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRK----ILH 145

  Fly   205 PKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQEV 269
            ..||. |.||||.::::...|::::.:.|:|:...|...:.....:||||....|.| |..||..
  Fly   146 ADYNL-NLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVTNDGTP-SRRLQRA 208

  Fly   270 QVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWG 332
            .|.......|| |::..::.::.:|..  ....|:|.|||||||  .:..:|:......|:||:|
  Fly   209 TVYNTDLHFCR-SKFTKQVDESQICAA--GTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYG 270

  Fly   333 EGCAKAGYPGVYARVNRYGTWIKN 356
            .....:.  .||..|..:..||.|
  Fly   271 SAACHSF--SVYTNVTHHRDWIVN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 71/262 (27%)
Tryp_SPc 127..356 CDD:238113 73/263 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/261 (27%)
Tryp_SPc 41..290 CDD:238113 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.