DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss48

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:259 Identity:93/259 - (35%)
Similarity:134/259 - (51%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV----YGFRKERI 177
            |||......||||||:..:.::||...|.:.....|..||::|.::|||:||:    |.|   ..
Mouse    30 VCGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSF---LY 91

  Fly   178 SVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS 242
            ||.|...||:.|...| :..|:.:....|:  |:.:.|||::||...|.|:.|:.|:|:|...:.
Mouse    92 SVWLGSIDREYSSTGK-EYYVSRIAIPDKH--RHTEADIALLKLSSRVTFSSVILPICLPNISKQ 153

  Fly   243 FKGENGI-VTGWGALKVGGPTSDTLQEVQVPILSQDECRK--SRYG-------NKITDNMLCGGY 297
            ....... |||||..:.|...| ||||::||::|.:.|.:  :..|       ..|.::|.|.|.
Mouse   154 LTVPASCWVTGWGQNQEGHYPS-TLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGE 217

  Fly   298 DEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQA 361
            .:..||||:|||||||.....|.  .::.||||||..|.| ..||||..|..|..||..:..:|
Mouse   218 RQSRKDSCKGDSGGPLSCHIDGV--WRLMGVVSWGLECGK-DLPGVYTNVTYYQKWISAIISRA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/241 (36%)
Tryp_SPc 127..356 CDD:238113 88/242 (36%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 87/241 (36%)
Tryp_SPc 40..274 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.