DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Ser8

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:81/250 - (32%)
Similarity:115/250 - (46%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV------------YGFRKERIS 178
            |||||..:.:...||...|...|..:|..|::::..::||:||:            .|..|....
  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYG 98

  Fly   179 VRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM--PTPGR 241
            ..|:|              ||.:..|..||:.:..|||.:::|...:.|...:..:.|  .||..
  Fly    99 GVLVE--------------VAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAH 149

  Fly   242 SFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR--YGNKITDNMLCGGYDEGGKDS 304
               |....::|||.....||:|.||..|...|:.:.:|..|.  ||:.|...|:|..  ...||:
  Fly   150 ---GSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDA 209

  Fly   305 CQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTK 359
            |||||||||  |:.|    |:.||||||..||.|.||||||.:.....|:....|
  Fly   210 CQGDSGGPL--VSGG----QLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 79/243 (33%)
Tryp_SPc 127..356 CDD:238113 79/244 (32%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 79/243 (33%)
Tryp_SPc 35..253 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.