DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and thetaTry

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:263 Identity:88/263 - (33%)
Similarity:137/263 - (52%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSDCVCGIAN-----IQKRIVGGQETEVHQYPW-VAMLLYGGRFYCAASLLNDQFLLTASHCVYG 171
            |:..| |::|     .:.|||||::|.:..:|: |::....|..:|..||:|:..::||:||:.|
  Fly    17 CAGTV-GVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVG 80

  Fly   172 FRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLH--PV 234
            .:..::.|||   ...:.:...|...|.|:..:..||::..:.|:.|:||||.|:..|.:.  .:
  Fly    81 RKVSKVFVRL---GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL 142

  Fly   235 CMPTPGRSFKGENGIVTGWGA------LKVGGPTSDTLQEVQVPILSQDECRKS--RYGNKITDN 291
            ...||.   .|...:|||||:      :.:    ..|||||.|.|:....|...  :||..|.|:
  Fly   143 ATETPP---TGTTAVVTGWGSKCYFWCMTL----PKTLQEVYVNIVDWKTCASDEYKYGEIIYDS 200

  Fly   292 MLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            |:| .| |..||:|||||||||.:      .:.:.|:||||..||....||||:.|.....||.|
  Fly   201 MVC-AY-EKKKDACQGDSGGPLAV------GNTLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257

  Fly   357 LTK 359
            .::
  Fly   258 ASE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 81/238 (34%)
Tryp_SPc 127..356 CDD:238113 82/239 (34%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 81/238 (34%)
Tryp_SPc 35..255 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.