DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and flz

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:483 Identity:131/483 - (27%)
Similarity:195/483 - (40%) Gaps:142/483 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALSCGPSQSASQ-DRATNQTAASPLLKQSQNTFIQWVLSLLP----------QRPGSSDSENAT 65
            |.:|...|...|. |.:|.......:||...:|.:..:::.|.          :.|||    |.|
  Fly  1214 LNMSAASSAVTSDLDLSTPAFVEDVVLKDKMHTLVHKLVASLQGNFEALADMIEEPGS----NKT 1274

  Fly    66 LATLSS------------SSMMPDAASTTS------------TTTPAPSSST----TTTRR---- 98
            :||..:            ::..|...:||:            .||.||:..|    ||||:    
  Fly  1275 VATYQAGAGGTAKPVRVVTTRKPVRTATTTRPKVTTKKPVTRVTTKAPNKKTSAVSTTTRKPATR 1339

  Fly    99 ---------ATTPAPPTLNPPRNCSDCV------------------------------------- 117
                     .||..|.|..|.|..|..|                                     
  Fly  1340 RTTVAAKVTTTTRRPATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNPNPSDNEIDQGA 1404

  Fly   118 ---------------------------------CGIANIQK--RIVGGQETEVHQYPWVAML--- 144
                                             ||:....|  |||||:.:....|||..::   
  Fly  1405 TLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRES 1469

  Fly   145 LYGGRF---YCAASLLNDQFLLTASHCVYGFRKERISVRLLEHD--RKMSHMQKIDRKVAEVITH 204
            .:.|.|   .|...|:..::::||:||..||....::| :.|.|  ..:...:.:.:.|..||.|
  Fly  1470 TWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAV-MGEFDISGDLESKRSVTKNVKRVIVH 1533

  Fly   205 PKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQEV 269
            .:|:...::||:|:::||.||:|:..:.|:|||.....|.|....|||||.||.||.....||||
  Fly  1534 RQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEV 1598

  Fly   270 QVPILSQDECRK----SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVS 330
            ||||:....|::    :.:..||..:.||.||..|.||||:||||||| ::......:::||.||
  Fly  1599 QVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPL-VLQRPDGRYELAGTVS 1662

  Fly   331 WGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            .|..||....||||.|...|..|::::|
  Fly  1663 HGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/239 (37%)
Tryp_SPc 127..356 CDD:238113 89/240 (37%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 89/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457806
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.