DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG8738

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:135/281 - (48%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NP-PRNCSDCV---CGIAN---IQKRIVG--GQETEVHQYPW-VAMLLYGGRFYCAASLLNDQFL 162
            || .||..|.:   ||.:|   :..::.|  ..|:...::|| ||::...|.|.|..:|::.|.:
  Fly   174 NPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLV 238

  Fly   163 LTASHCVYGFRKERISVRLLEHDRKMS---HMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEP 224
            ||::|.|:...::.:.||..:.|....   |..:: |.::|:..|..:|.....||||::.|:.|
  Fly   239 LTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQM-RAISELHRHENFNNLTLYNDIALVVLERP 302

  Fly   225 VEFNEVLHPVCMPTP-----GRSFKGENGIVTGWGALKVGGPTSDT-LQEVQVPILSQDECRK-- 281
            .:....:.|:|:|.|     ....:..:.:.||||.......|.:. |:.:::|.:..:.|::  
  Fly   303 FQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLL 367

  Fly   282 ------SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTRE-HQIAGVVSWGEGCAKAG 339
                  .||  .:..:..|.| ...|||:|.||.|.||.....|.:: :|:.|:||||..||:..
  Fly   368 RHTVLGRRY--NLHPSFTCAG-GVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKD 429

  Fly   340 YPGVYARVNRYGTWI-KNLTK 359
            .|..|..|.....|| :.:||
  Fly   430 VPAAYTNVAYLRNWIDEQVTK 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 66/248 (27%)
Tryp_SPc 127..356 CDD:238113 68/250 (27%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 67/243 (28%)
Tryp_SPc 207..444 CDD:214473 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.