DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss33

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:350 Identity:118/350 - (33%)
Similarity:163/350 - (46%) Gaps:44/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLKQSQNTFIQWVLSLLPQ-RPGSSDSENATLATLSSSSMMP-------DAASTTSTTTPAPSSS 92
            :||.|....:|    :.|| |.|..:.....|..|.|...:|       .|:.|....|...:||
Mouse     1 MLKASLFKAVQ----VRPQLRLGLDNYLGLHLLCLLSPQDLPWPHQREHQASRTRDQATCTQASS 61

  Fly    93 TTTTRRATTPAPPTL----NPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCA 153
            ..|.|.|:......|    ...:.|:  .||...:..|||||::.:..::||...:.:.|...|.
Mouse    62 EDTMRGASHLQILLLLVLGTRMQECA--ACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCG 124

  Fly   154 ASLLNDQFLLTASHCVYGFRK----ERISVRL--LEHDRKMSHMQKIDRKVAEVITHPKYNARNY 212
            .||:..|::|||.||   |.:    ...||.|  |..|.:.||...:  .|..|:..|.|:....
Mouse   125 GSLIAPQWVLTAGHC---FPRRVWPSEYSVLLGALSLDVRSSHELLV--PVLRVLLPPDYSEDEA 184

  Fly   213 DNDIAIIKLDEPVEFNEVLHPVCMPTPG-RSFKGENGIVTGWGALKVGG--PTSDTLQEVQVPIL 274
            ..|:|:::|..||..:..:.|||:|.|| ....|....|||||:|..|.  |....||.|:||:|
Mouse   185 RGDLALLQLRHPVSLSTRIQPVCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLL 249

  Fly   275 SQDECRKSRY-------GNKIT-DNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQI-AGVVS 330
            ....|.:..:       |.:|. ...||.||..|.||:|||||||||..:.||   |.: .||||
Mouse   250 DSRACDRLYHVGANVPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESG---HWVLVGVVS 311

  Fly   331 WGEGCAKAGYPGVYARVNRYGTWIK 355
            ||:|||....||||..|.:|..||:
Mouse   312 WGKGCALPNRPGVYTNVAKYSPWIQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 92/245 (38%)
Tryp_SPc 127..356 CDD:238113 93/246 (38%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 92/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.