DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and l(2)k05911

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:371 Identity:127/371 - (34%)
Similarity:180/371 - (48%) Gaps:54/371 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PLLKQSQNTF--IQWVLS---------LLPQRPGSSDSENATLATLSSSSMMPDAAST-----TS 83
            |:..|..:|.  .||...         .||..|.::......|.|...:...|...:|     |.
  Fly   274 PISTQPASTIHPYQWPFGSFAGGQWPPALPTHPPTTGGWPPPLPTHPPNHHYPTHPTTGGVPSTK 338

  Fly    84 TTTPAPSSST--TTTRRATTPAPP--------TLNPPRNCSD----CVCGIAN----IQKRIVGG 130
            .|||.|:|..  |||||.|.|:.|        |..|....|.    ..||..|    .|:|||||
  Fly   339 RTTPRPTSPARPTTTRRPTYPSYPSPVTTTTTTRRPVSGTSSEGLPLQCGNKNPVTPDQERIVGG 403

  Fly   131 QETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEH--DRKMS---H 190
            .....|::||:|:|...|:.:|..||:.:..:|||:|||.......::. |..|  |..:.   .
  Fly   404 INASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAA-LTAHLGDYNIGTDFE 467

  Fly   191 MQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPT----PGRSFKGENGIVT 251
            :|.:.|::..::.|..:......||:||:.|.|||.|...:.|:|:||    ..||:.|:...|.
  Fly   468 VQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVA 532

  Fly   252 GWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNK----ITDNMLCGGYDEGGKDSCQGDSGGP 312
            |||:|:..||....||:|.:||.:..||.: :||..    |.::|:|.|  :..||||.||||||
  Fly   533 GWGSLRENGPQPSILQKVDIPIWTNAECAR-KYGRAAPGGIIESMICAG--QAAKDSCSGDSGGP 594

  Fly   313 LHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI-KNL 357
            : ::..|.|..|: |:||||.||.|..|||||.||.....|| ||:
  Fly   595 M-VINDGGRYTQV-GIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/240 (38%)
Tryp_SPc 127..356 CDD:238113 91/242 (38%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 90/240 (38%)
Tryp_SPc 400..637 CDD:238113 91/242 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.910

Return to query results.
Submit another query.