DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and prss60.3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:249 Identity:93/249 - (37%)
Similarity:137/249 - (55%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGIANIQKRIVGGQETEVHQYPWVAML---LYGGRFYCAASLLNDQFLLTASHCVYGFRKERIS 178
            |||.|.:..|||||.......:||...|   .|||.| |..||::.:::|||:||:.|..:..:.
Zfish    26 VCGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHF-CGGSLISSEWVLTAAHCLSGVSETTLV 89

  Fly   179 VRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF 243
            |.|....::..::.:..|.||:...|..||:...|||||:::|...|.|...:.|||:......:
Zfish    90 VYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVY 154

  Fly   244 K-GENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSC 305
            . |.:..:||||.::.|.  |....|||..:|:::.|.|........:|:||:|.|..:||||:|
Zfish   155 SAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKDTC 219

  Fly   306 QGDSGGPLHIVASGTREHQI---AGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            |||||||:     .||...:   ||:.|||.|||....||||.||::|.:||.:
Zfish   220 QGDSGGPM-----VTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/236 (37%)
Tryp_SPc 127..356 CDD:238113 88/237 (37%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 88/239 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587864
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.