DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG18557

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:314 Identity:79/314 - (25%)
Similarity:137/314 - (43%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPDAASTTST------TTPAP----SSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQKRIVG 129
            :|.....||.      :.|:|    .|...::::....||  ||         ||.:|  ...:|
  Fly    29 VPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAP--LN---------CGKSN--PNGLG 80

  Fly   130 GQETEV------HQYPW-VAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRK 187
            |...||      :::|| ||::.....|:.|.:|:.:..::||:|.:.........:.....|.|
  Fly    81 GTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLK 145

  Fly   188 MSHMQKID-RKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVT 251
            ....:.|. |....:::||.:|.....|:||:|.|:........:.|:|.||.|.||..|..:|.
  Fly   146 QLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVA 210

  Fly   252 GWGALKVGGPTSDTL--------QEVQVPILSQDEC----RKSRY--GNKITDNMLCGGYDEGGK 302
            |||       ..|.|        :::.:||:|:.:|    |::.:  ..::...:||.| .|.|:
  Fly   211 GWG-------RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGR 267

  Fly   303 DSCQGDSGGPLHIVASG-TREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
            |:|.||.|.||.....| ...:::.|:|:.|..|.....|.:|..::....||:
  Fly   268 DACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 64/250 (26%)
Tryp_SPc 127..356 CDD:238113 66/252 (26%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 62/242 (26%)
Tryp_SPc 90..320 CDD:214473 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.