DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Send1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:117/261 - (44%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTA 165
            :|..|.|..|             .:||:||...::...||...|.|.|..:|..|:.:...::||
  Fly    17 SPVVPVLLEP-------------SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITA 68

  Fly   166 SHCV-YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNE 229
            :||: .|.|..|....|  ||     ...:...|...|.||:::..|.:||:|::||..|:.|::
  Fly    69 AHCIKEGERSIRAGSSL--HD-----SGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSD 126

  Fly   230 VLH--PVCMPTPGRSFKGENGIVTGWGALKVGG----PTSDTLQEVQVPILSQDECRKSRYGNKI 288
            .:.  |:....|..|   .:.:.||||.   |.    |..  ||.|::.|.....| |.:|||.:
  Fly   127 SIQTIPLAETDPPTS---SSALATGWGR---GNFLIRPRQ--LQGVEILIRPLIVC-KLKYGNGV 182

  Fly   289 TDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTW 353
            .:..:|.|  ..||..|.|||||||  |.:|    |:.|:.|........| ..:||.|.||..|
  Fly   183 FNEDICAG--RMGKGGCYGDSGGPL--VFNG----QLVGITSRTGNIVCLG-SSLYASVARYRNW 238

  Fly   354 I 354
            |
  Fly   239 I 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 74/234 (32%)
Tryp_SPc 127..356 CDD:238113 75/235 (32%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 74/234 (32%)
Tryp_SPc 30..239 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.