DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Ser6

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:246 Identity:73/246 - (29%)
Similarity:118/246 - (47%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYG---------FRKERISVRL 181
            |:|||::...:|:|....|...|...|..|:|...::|||:|||..         ...||.::|.
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95

  Fly   182 LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMP---TPGRSF 243
            ..:||....:..   :|||||.|.:|.  |:.||:|:::|:.|:..:..:.|:.:|   ||.   
  Fly    96 GSNDRFSGGVLV---QVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTVDTPA--- 152

  Fly   244 KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRK-SRYGNKITDNMLC--GGYDEGGKDSC 305
             ..:.:::|||.:|..|.....||...:..:::.:|.: ..:|   .:..||  ...|.|   :|
  Fly   153 -DVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFG---FEGELCLLHQVDNG---AC 210

  Fly   306 QGDSGGPLHIVASGTREHQIAGVVSW-GEGCAKAGYPGVYARVNRYGTWIK 355
            .||||||      ....:|:.||..: .:||... ||..||||..:..|||
  Fly   211 NGDSGGP------AVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 70/243 (29%)
Tryp_SPc 127..356 CDD:238113 72/245 (29%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/243 (29%)
Tryp_SPc 32..256 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.